Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectsmeadowtropical
Larkspur Flower from Larkspur
Common Buttercup Flower from Buttercup
Anethum graveolens or Dill from Herb
Caterpillar and Buttefly from Caterpillar
Hemerocallis Spp or Day Lily from Perennial
Flower Poppy from Red
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Orchids from Orchid
Rhododendron Calendulaceum or Flame Azalea from Azalea
Europeana Floribunda Rose from Roses
Pollinators of Alaska from Nps
Iris Motif from Iris
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Disa Kewensis Orchid from Orchid
Black Elderberry from Elderberry
Orchid Lycaste Aromatica from Orchid
Iris Flower Blossom from Iris
Chrysanthemum 1 from Perennial
Double Delight Hybrid Tea Rose from Roses
Apple Blossom Branch from Apple tree
Steampunk Bee from Steampunk animals coloring book
Daffodil from Daffodil
Butterfly from Cartoon animals viii coloring book
Cosmos Scabiosoides from Cosmos
Bumblebee from Woodland animals
Bee from Cartoon animals v coloring book
Swallow Tail Hummingbird from Hummingbirds
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Bee from Cartoon animals viii coloring book
Spring Crocus from Crocus
Black Raspberry from Celebrating wildflowers coloring book
Heliconia Indica from Heliconia
Bug from Animals
Chinese Peony from Flowers
Hibiscus Flower from Hawaii flower
Butterfly from Cartoon animals vii coloring book
Common Fruit Bats from Realistic animals coloring book
Cherokee Rose from Roses
Hibiscus from Realistic flowers
American Twinflower from Celebrating wildflowers coloring book
Ladybug from Cartoon animals v coloring book
Ladybug from Cartoon animals viii coloring book
Bumblebee from Simple objects coloring book
Daisy from Simple objects iv coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Bumblebee from Bumblebee
Realistic Sunflowers from Sunflower
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
Hummingbird from Cartoon animals ii coloring book
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Renanthera Imschootiana Orchid from Orchid
Hyacinth Flower from Hyacinthus
Grasshopper on the Flower from Grasshoppers
Rabbit Smelling Tulip from Grass
Aquilegia Truncata Red Columbine from Columbine
Schlumbergera Bloom from Cactus
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Viola Adunca or Pale Mountain Violet from Violet
Cirsium Vulgare or Bull Thistle from Thistle
Clarkia Amoena Farewell to Spring from Godetia
Oriental poppy from Perennial
Daffodil Flowers from Daffodil
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Heliconia Psittacorum from Heliconia
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Cornflower, Blue Bottle from Cornflowers
Bluebell Bellflower from Bellflower
Burke's Larkspur from Celebrating wildflowers coloring book
Scarlet Carnation from Carnation
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Ranunculus Acris from Buttercup
Butterfly Flies On A Flower from Flowers
Tropical Vanda Tricolor Orchid from Orchid
Common Evening Primrose or Evening Star from Primrose
Grasshopper on Flower from Grasshoppers
Aster 1 from Asters
Cornflower from Cornflowers
Sophronitis Cernua Orchid from Orchid
Grasshopper in Garden from Grasshoppers
Sundowner Rosa Grandiflora from Roses
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Bug from Cartoon animals coloring book
Wildflower from Plants ii coloring book
Black Locust from Locust tree
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Big-Headed Clover from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Life Cycle of Monarch Butterfly from Biology
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Daffodil from Daffodil
Chrysanthemum Morifolium from Flower garden
Anemone Coronaria from Anemone
Chrysanthemum Carinatum from Realistic flowers
Pink Hibiscus from Realistic flowers
201 - 300 of 1,830 Next page
/ 19